Recombinant Human SREK1IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SREK1IP1-2304H
• Product Overview: SFRS12IP1 MS Standard C13 and N15-labeled recombinant protein (NP_776190) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Possible splicing regulator involved in the control of cellular survival.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 18.2 kDa
• AA Sequence: MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEKRINEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKEKKSKSKKGKHHKKEKKKRKKEKHSSTPNSSEFSRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SREK1IP1 SREK1-interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: SREK1IP1
• Synonyms: SREK1IP1; SREK1-interacting protein 1; SFRS12 interacting protein 1, SFRS12IP1; protein SREK1IP1; FLJ36754; p18 splicing regulatory protein; P18SRP; protein SFRS12IP1; SFRS12-interacting protein 1; splicing regulatory protein of 18 kDa; SFRS12IP1; MGC131910; MGC150548; MGC150549
• Gene ID: 285672
• mRNA Refseq: NM_173829
• Protein Refseq: NP_776190
• UniProt ID: Q8N9Q2