Recombinant Human SREBF2 protein, His-tagged
Cat.No. : | SREBF2-3652H |
Product Overview : | Recombinant Human SREBF2 protein(375-479 aa), fused to His tag, was expressed in E. coli. |
Availability | April 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 375-479 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SREBF2 sterol regulatory element binding transcription factor 2 [ Homo sapiens ] |
Official Symbol | SREBF2 |
Synonyms | SREBF2; sterol regulatory element binding transcription factor 2; sterol regulatory element-binding protein 2; bHLHd2; SREBP2; SREBP-2; class D basic helix-loop-helix protein 2; sterol regulatory element-binding transcription factor 2; |
Gene ID | 6721 |
mRNA Refseq | NM_004599 |
Protein Refseq | NP_004590 |
MIM | 600481 |
UniProt ID | Q12772 |
◆ Recombinant Proteins | ||
SREBF2-5575Z | Recombinant Zebrafish SREBF2 | +Inquiry |
SREBF2-5737R | Recombinant Rat SREBF2 Protein | +Inquiry |
RFL21952MF | Recombinant Full Length Mouse Sterol Regulatory Element-Binding Protein 2(Srebf2) Protein, His-Tagged | +Inquiry |
RFL31101XF | Recombinant Full Length Xenopus Laevis Sterol Regulatory Element-Binding Protein 2(Srebf2) Protein, His-Tagged | +Inquiry |
SREBF2-15974M | Recombinant Mouse SREBF2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SREBF2 Products
Required fields are marked with *
My Review for All SREBF2 Products
Required fields are marked with *
0
Inquiry Basket