Recombinant Human SREBF2 protein, His-tagged

• Cat.No.: SREBF2-3652H
• Product Overview: Recombinant Human SREBF2 protein(375-479 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 375-479 aa
• AA Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SREBF2 sterol regulatory element binding transcription factor 2 [ Homo sapiens ]
• Official Symbol: SREBF2
• Synonyms: SREBF2; sterol regulatory element binding transcription factor 2; sterol regulatory element-binding protein 2; bHLHd2; SREBP2; SREBP-2; class D basic helix-loop-helix protein 2; sterol regulatory element-binding transcription factor 2
• Gene ID: 6721
• mRNA Refseq: NM_004599
• Protein Refseq: NP_004590
• MIM: 600481
• UniProt ID: Q12772