Recombinant Human SRD5A2L2 protein, GST-tagged

• Cat.No.: SRD5A2L2-301306H
• Product Overview: Recombinant Human SRD5A2L2 (1-143 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Met1-Trp143
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MFKRHKSLASERKRALLSQRATRFILKDDMRNFHFLSKLVLSAGPLRPTPAVKHSKTTHFEIEIFDAQTRKQICILDKVTQSSTIHDVKQKFHKACPKWYPSRVGLQLECGGPFLKDYITIQSIAASSIVTLYATDLGQQVSW
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TECRL trans-2,3-enoyl-CoA reductase like [ Homo sapiens (human) ]
• Official Symbol: SRD5A2L2
• Synonyms: TERL; CPVT3; GPSN2L; TECRL
• Gene ID: 253017
• mRNA Refseq: NM_001010874
• Protein Refseq: NP_00101087
• MIM: 617242
• UniProt ID: Q5HYJ1