Recombinant Human src kinase associated phosphoprotein 1 protein, His tagged

• Cat.No.: SKAP1-01H
• Product Overview: Recombinant Human SKAP1 protein (1-358aa) with His tag was expressed in E. coli.

Specification

• Description: This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.
• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 1-358aa
• Molecular Mass: 42 kDa
• AA Sequence: MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEERHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: SKAP1 src kinase associated phosphoprotein 1 [ Homo sapiens (human) ]
• Official Symbol: SKAP1
• Synonyms: SKAP1; src kinase associated phosphoprotein 1; SCAP1, src family associated phosphoprotein 1; src kinase-associated phosphoprotein 1; SKAP55; pp55; SKAP-55; src family associated phosphoprotein 1; src family-associated phosphoprotein 1; src kinase-associated phosphoprotein of 55 kDa; SCAP1
• Gene ID: 8631
• mRNA Refseq: NM_001075099
• Protein Refseq: NP_001068567
• MIM: 604969
• UniProt ID: Q86WV1