Recombinant Human SPRYD3 Protein, GST-tagged

• Cat.No.: SPRYD3-4248H
• Product Overview: Human FLJ14800 partial ORF ( NP_116229, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SPRYD3 (SPRY Domain Containing 3) is a Protein Coding gene. An important paralog of this gene is RANBP9.
• Molecular Mass: 36.74 kDa
• AA Sequence: MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHGNSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPRYD3 SPRY domain containing 3 [ Homo sapiens ]
• Official Symbol: SPRYD3
• Synonyms: SPRYD3; SPRY domain containing 3; SPRY domain-containing protein 3; FLJ14800
• Gene ID: 84926
• mRNA Refseq: NM_032840
• Protein Refseq: NP_116229
• UniProt ID: Q8NCJ5