Recombinant Human SPRR4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPRR4-2886H
Product Overview : SPRR4 MS Standard C13 and N15-labeled recombinant protein (NP_775103) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Cross-linked envelope protein of keratinocytes. Involved in UV-induced cornification.
Molecular Mass : 8.8 kDa
AA Sequence : MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSAQQASKSKQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPRR4 small proline rich protein 4 [ Homo sapiens (human) ]
Official Symbol SPRR4
Synonyms SPRR4; small proline rich protein 4; small proline-rich protein 4;
Gene ID 163778
mRNA Refseq NM_173080
Protein Refseq NP_775103
MIM 616363
UniProt ID Q96PI1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SPRR4 Products

Required fields are marked with *

My Review for All SPRR4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon