Recombinant Human SPRR2F Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPRR2F-4569H
Product Overview : SPRR2F MS Standard C13 and N15-labeled recombinant protein (NP_001014450) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SPRR2F (Small Proline Rich Protein 2F) is a Protein Coding gene. Diseases associated with SPRR2F include Adenine Phosphoribosyltransferase Deficiency and Necrotizing Ulcerative Gingivitis. Among its related pathways are Keratinization and Developmental Biology.
Molecular Mass : 7.6 kDa
AA Sequence : MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPRR2F small proline-rich protein 2F [ Homo sapiens (human) ]
Official Symbol SPRR2F
Synonyms SPRR2F; small proline-rich protein 2F; SPR-2F;
Gene ID 6705
mRNA Refseq NM_001014450
Protein Refseq NP_001014450
MIM 617589
UniProt ID Q96RM1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SPRR2F Products

Required fields are marked with *

My Review for All SPRR2F Products

Required fields are marked with *

0

Inquiry Basket

cartIcon