Recombinant Human SPRR2D Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPRR2D-4794H
• Product Overview: SPRR2D MS Standard C13 and N15-labeled recombinant protein (NP_008876) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 7.7 kDa
• AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPRR2D small proline rich protein 2D [ Homo sapiens (human) ]
• Official Symbol: SPRR2D
• Synonyms: SPRR2D; small proline rich protein 2D; small proline-rich protein 2D; SPR-2D; SPR-II; small proline-rich protein II
• Gene ID: 6703
• mRNA Refseq: NM_006945
• Protein Refseq: NP_008876
• MIM: 617587
• UniProt ID: P22532