Recombinant Human SPRR2D Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPRR2D-4794H |
Product Overview : | SPRR2D MS Standard C13 and N15-labeled recombinant protein (NP_008876) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. |
Molecular Mass : | 7.7 kDa |
AA Sequence : | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPRR2D small proline rich protein 2D [ Homo sapiens (human) ] |
Official Symbol | SPRR2D |
Synonyms | SPRR2D; small proline rich protein 2D; small proline-rich protein 2D; SPR-2D; SPR-II; small proline-rich protein II |
Gene ID | 6703 |
mRNA Refseq | NM_006945 |
Protein Refseq | NP_008876 |
MIM | 617587 |
UniProt ID | P22532 |
◆ Recombinant Proteins | ||
SPRR2D-4794H | Recombinant Human SPRR2D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPRR2D-1265H | Recombinant Human SPRR2D | +Inquiry |
SPRR2D-2934H | Recombinant Human SPRR2D, GST-tagged | +Inquiry |
SPRR2D-8682M | Recombinant Mouse SPRR2D Protein, His (Fc)-Avi-tagged | +Inquiry |
SPRR2D-2677H | Recombinant Human SPRR2D Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPRR2D Products
Required fields are marked with *
My Review for All SPRR2D Products
Required fields are marked with *
0
Inquiry Basket