Recombinant Human SPRR1B

• Cat.No.: SPRR1B-30402TH
• Product Overview: Recombinant full length Human SPRR1b with N terminal proprietary tag; Predicted MWt 35.90 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 89 amino acids
• Molecular Weight: 35.900kDa inclusive of tags
• Tissue specificity: Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSSQQQKQPCIPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK
• Sequence Similarities: Belongs to the cornifin (SPRR) family.

Gene Information

• Gene Name: SPRR1B small proline-rich protein 1B [ Homo sapiens ]
• Official Symbol: SPRR1B
• Synonyms: SPRR1B; small proline-rich protein 1B; SPRR1; cornifin-B; cornifin; GADD33
• Gene ID: 6699
• mRNA Refseq: NM_003125
• Protein Refseq: NP_003116
• MIM: 182266
• Uniprot ID: P22528
• Chromosome Location: 1q21-q22
• Function: protein binding, bridging; structural molecule activity