Recombinant Human SPRED1 protein, His-SUMO & Myc-tagged

• Cat.No.: SPRED1-4593H
• Product Overview: Recombinant Human SPRED1 protein(Q7Z699)(2-444aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 2-444aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 70.3 kDa
• AA Sequence: SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SPRED1 sprouty-related, EVH1 domain containing 1 [ Homo sapiens ]
• Official Symbol: SPRED1
• Synonyms: SPRED1; sprouty-related, EVH1 domain containing 1; sprouty-related, EVH1 domain-containing protein 1; FLJ33903; hSpred1; spred-1; suppressor of Ras/MAPK activation; EVH1/Sprouty domain containing protein; NFLS
• Gene ID: 161742
• mRNA Refseq: NM_152594
• Protein Refseq: NP_689807
• MIM: 609291
• UniProt ID: Q7Z699