Recombinant Human SPP1, StrepII-tagged

Cat.No. : SPP1-260H
Product Overview : Purified, full-length human recombinant OSTP (SPP1) or Osteopontin protein (amino acids 17-314, 298 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 33.7 kDa. (Accession NP_001035149.1; UniProt P10451)
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Osteopontin is involved in the attachment of osteoclasts to the mineralized bone matrix. It is secreted and binds hydroxyapatite with high affinity. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12.
Source : Human Cells
Species : Human
Tag : StrepII
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length : 17-314, 298 a.a.
AA Sequence : IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSID SNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAI PVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHE LDSASSEVN
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name SPP1 secreted phosphoprotein 1 [ Homo sapiens ]
Official Symbol SPP1
Synonyms SPP1; secreted phosphoprotein 1; BNSP, bone sialoprotein I , OPN, osteopontin; osteopontin; BSPI; early T lymphocyte activation 1; ETA 1; uropontin; nephropontin; osteopontin-C; osteopontin-D; SPP1/CALPHA1 fusion; bone sialoprotein 1; urinary stone protein; early T-lymphocyte activation 1; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); OPN; BNSP; ETA-1; MGC110940;
Gene ID 6696
mRNA Refseq NM_000582
Protein Refseq NP_000573
MIM 166490
UniProt ID P10451
Chromosome Location 4q22.1
Pathway Direct p53 effectors, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem;
Function cytokine activity; extracellular matrix binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SPP1 Products

Required fields are marked with *

My Review for All SPP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon