Recombinant Human SPP1, StrepII-tagged
Cat.No. : | SPP1-260H |
Product Overview : | Purified, full-length human recombinant OSTP (SPP1) or Osteopontin protein (amino acids 17-314, 298 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 33.7 kDa. (Accession NP_001035149.1; UniProt P10451) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 17-314, 298 a.a. |
Description : | Osteopontin is involved in the attachment of osteoclasts to the mineralized bone matrix. It is secreted and binds hydroxyapatite with high affinity. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSID SNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAI PVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHE LDSASSEVN |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | SPP1 secreted phosphoprotein 1 [ Homo sapiens ] |
Official Symbol | SPP1 |
Synonyms | SPP1; secreted phosphoprotein 1; BNSP, bone sialoprotein I , OPN, osteopontin; osteopontin; BSPI; early T lymphocyte activation 1; ETA 1; uropontin; nephropontin; osteopontin-C; osteopontin-D; SPP1/CALPHA1 fusion; bone sialoprotein 1; urinary stone protein; early T-lymphocyte activation 1; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); OPN; BNSP; ETA-1; MGC110940; |
Gene ID | 6696 |
mRNA Refseq | NM_000582 |
Protein Refseq | NP_000573 |
MIM | 166490 |
UniProt ID | P10451 |
Chromosome Location | 4q22.1 |
Pathway | Direct p53 effectors, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; |
Function | cytokine activity; extracellular matrix binding; |
◆ Recombinant Proteins | ||
Spp1-1772M | Recombinant Mouse Secreted Phosphoprotein 1 | +Inquiry |
SPP1-2680H | Recombinant Human SPP1 Protein, MYC/DDK-tagged | +Inquiry |
SPP1-1164P | Recombinant Pig SPP1 Protein, His-tagged | +Inquiry |
SPP1-0598M | Recombinant Mouse SPP1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
SPP1-28248TH | Recombinant Human SPP1, MBP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPP1-2535HCL | Recombinant Human SPP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPP1 Products
Required fields are marked with *
My Review for All SPP1 Products
Required fields are marked with *
0
Inquiry Basket