Recombinant Human SPP1 protein(231-300 aa), C-His-tagged

• Cat.No.: SPP1-2628H
• Product Overview: Recombinant Human SPP1 protein(P10451)(231-300 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 231-300 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• AASequence: DDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SPP1 secreted phosphoprotein 1 [ Homo sapiens ]
• Official Symbol: SPP1
• Synonyms: SPP1; secreted phosphoprotein 1; BNSP, bone sialoprotein I , OPN, osteopontin; osteopontin; BSPI; early T lymphocyte activation 1; ETA 1; uropontin; nephropontin; osteopontin-C; osteopontin-D; SPP1/CALPHA1 fusion; bone sialoprotein 1; urinary stone protein; early T-lymphocyte activation 1; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); OPN; BNSP; ETA-1; MGC110940
• Gene ID: 6696
• mRNA Refseq: NM_000582
• Protein Refseq: NP_000573
• MIM: 166490
• UniProt ID: P10451