Recombinant Human SPINT4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPINT4-6529H
• Product Overview: SPINT4 MS Standard C13 and N15-labeled recombinant protein (NP_848550) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SPINT4 (Serine Peptidase Inhibitor, Kunitz Type 4) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase inhibitor activity. An important paralog of this gene is TFPI2.
• Molecular Mass: 11.2 kDa
• AA Sequence: MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLKIEREVACVAKYKPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPINT4 serine peptidase inhibitor, Kunitz type 4 [ Homo sapiens (human) ]
• Official Symbol: SPINT4
• Synonyms: SPINT4; serine peptidase inhibitor, Kunitz type 4; SPINT3; C20orf137; dJ601O1.1; kunitz-type protease inhibitor 4; epididymis secretory sperm binding protein; serine protease inhibitor, Kunitz type 1; serine protease inhibitor, Kunitz type 4
• Gene ID: 391253
• mRNA Refseq: NM_178455
• Protein Refseq: NP_848550
• UniProt ID: Q6UDR6