Recombinant Human SPINT3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPINT3-1575H
• Product Overview: SPINT3 MS Standard C13 and N15-labeled recombinant protein (NP_006643) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SPINT3 (Serine Peptidase Inhibitor, Kunitz Type 3) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase inhibitor activity.
• Molecular Mass: 10.1 kDa
• AA Sequence: MQLQASLSFLLILTLCLELRSELARDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPINT3 serine peptidase inhibitor, Kunitz type 3 [ Homo sapiens (human) ]
• Official Symbol: SPINT3
• Synonyms: SPINT3; serine peptidase inhibitor, Kunitz type 3; HKIB9; kunitz-type protease inhibitor 3; serine protease inhibitor, Kunitz type, 3
• Gene ID: 10816
• mRNA Refseq: NM_006652
• Protein Refseq: NP_006643
• MIM: 613941
• UniProt ID: P49223