Recombinant Human SPINLW1 protein, GST-tagged

• Cat.No.: SPINLW1-325H
• Product Overview: Recombinant Human SPINLW1(1 a.a. - 133 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 41.7 kDa
• AA Sequence: MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQD VCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-133 a.a.

Gene Information

• Gene Name: SPINLW1 serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) [ Homo sapiens ]
• Official Symbol: SPINLW1
• Synonyms: SPINLW1; serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin); serine protease inhibitor like, with Kunitz and WAP domains 1 (eppin); eppin; cancer/testis antigen 72; CT72; dJ461P17.2; epididymal protease inhibitor; EPPIN; EPPIN1; EPPIN2; EPPIN3; WAP7; WFDC7; protease inhibitor WAP7; cancer/testis antigen 71; WAP four-disulfide core domain protein 7; CT71
• Gene ID: 57119
• mRNA Refseq: NM_020398
• Protein Refseq: NP_065131
• MIM: 609031
• UniProt ID: O95925
• Chromosome Location: 20q12-q13.2
• Function: peptidase inhibitor activity; serine-type endopeptidase inhibitor activity