Recombinant Human SPINLW1 protein, GST-tagged
Cat.No. : | SPINLW1-325H |
Product Overview : | Recombinant Human SPINLW1(1 a.a. - 133 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 41.7 kDa |
AA Sequence : | MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQD VCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Protein length : | 1-133 a.a. |
Gene Name | SPINLW1 serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin) [ Homo sapiens ] |
Official Symbol | SPINLW1 |
Synonyms | SPINLW1; serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin); serine protease inhibitor like, with Kunitz and WAP domains 1 (eppin); eppin; cancer/testis antigen 72; CT72; dJ461P17.2; epididymal protease inhibitor; EPPIN; EPPIN1; EPPIN2; EPPIN3; WAP7; WFDC7; protease inhibitor WAP7; cancer/testis antigen 71; WAP four-disulfide core domain protein 7; CT71; |
Gene ID | 57119 |
mRNA Refseq | NM_020398 |
Protein Refseq | NP_065131 |
MIM | 609031 |
UniProt ID | O95925 |
Chromosome Location | 20q12-q13.2 |
Function | peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SPINLW1 Products
Required fields are marked with *
My Review for All SPINLW1 Products
Required fields are marked with *
0
Inquiry Basket