Recombinant Human SPINK7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPINK7-4012H
• Product Overview: SPINK7 MS Standard C13 and N15-labeled recombinant protein (NP_115955) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Probable serine protease inhibitor.
• Molecular Mass: 9.2 kDa
• AA Sequence: MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPINK7 serine peptidase inhibitor Kazal type 7 [ Homo sapiens (human) ]
• Official Symbol: SPINK7
• Synonyms: SPINK;7 serine peptidase inhibitor, Kazal type 7 (putative); ECG2; ECRG2; serine protease inhibitor Kazal-type 7; ECRG-2; esophagus cancer-related gene 2 protein; esophagus cancer-related gene-2; serine peptidase inhibitor, Kazal type 7 (putative)
• Gene ID: 84651
• mRNA Refseq: NM_032566
• Protein Refseq: NP_115955
• MIM: 617288
• UniProt ID: P58062