Recombinant Human SPG7 protein, His-tagged

• Cat.No.: SPG7-2841H
• Product Overview: Recombinant Human SPG7 protein(362-406 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 362-406 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: VATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYI
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SPG7 spastic paraplegia 7 (pure and complicated autosomal recessive) [ Homo sapiens ]
• Official Symbol: SPG7
• Synonyms: SPG7; spastic paraplegia 7 (pure and complicated autosomal recessive); cell matrix adhesion regulator , CMAR; paraplegin; CAR; SPG5C; paraplegin, isoform 1; cell adhesion regulator; spastic paraplegia 7 protein; cell matrix adhesion regulator; PGN; CMAR; FLJ37308; MGC126331; MGC126332
• Gene ID: 6687
• mRNA Refseq: NM_003119
• Protein Refseq: NP_003110
• MIM: 602783
• UniProt ID: Q9UQ90