Recombinant Human SPDYE2 Protein, GST-tagged

• Cat.No.: SPDYE2-4358H
• Product Overview: Human MGC119295 full-length ORF ( NP_001026789.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SPDYE2 (Speedy/RINGO Cell Cycle Regulator Family Member E2) is a Protein Coding gene. Among its related pathways are Oocyte meiosis. GO annotations related to this gene include protein kinase binding. An important paralog of this gene is SPDYE6.
• Molecular Mass: 58.2 kDa
• AA Sequence: MEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKRWFQLGHSMNPRARKNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPDYE2 speedy/RINGO cell cycle regulator family member E2 [ Homo sapiens (human) ]
• Official Symbol: SPDYE2
• Synonyms: SPDYE2; speedy/RINGO cell cycle regulator family member E2; SPDYB2-L1; speedy protein E2; Speedy B2-like 1; putative Speedy protein E2; speedy homolog E2
• Gene ID: 441273
• mRNA Refseq: NM_001031618
• Protein Refseq: NP_001026789
• MIM: 617624
• UniProt ID: Q495Y8