Recombinant Human SPCS1 protein, His-tagged

• Cat.No.: SPCS1-4005H
• Product Overview: Recombinant Human SPCS1 protein(1 - 102 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1 - 102 aa
• AA Sequence: MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SPCS1 signal peptidase complex subunit 1 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SPCS1
• Synonyms: SPCS1; signal peptidase complex subunit 1 homolog (S. cerevisiae); signal peptidase complex subunit 1; HSPC033; SPC1; SPC12; YJR010C A; SPase 12 kDa subunit; signal peptidase 12kDa; microsomal signal peptidase 12 kDa subunit; YJR010C-A
• Gene ID: 28972
• mRNA Refseq: NM_014041
• Protein Refseq: NP_054760
• MIM: 610358
• UniProt ID: Q9Y6A9