Recombinant Human SPATA25 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPATA25-3768H
• Product Overview: C20orf165 MS Standard C13 and N15-labeled recombinant protein (NP_542175) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: SPATA25 (Spermatogenesis Associated 25) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 23.8 kDa
• AA Sequence: MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQAWGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPSRPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWAAQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPATA25 spermatogenesis associated 25 [ Homo sapiens (human) ]
• Official Symbol: SPATA25
• Synonyms: SPATA25; spermatogenesis associated 25; TSG23; C20orf165; dJ337O18.8; spermatogenesis-associated protein 25; testis-specific gene 23 protein
• Gene ID: 128497
• mRNA Refseq: NM_080608
• Protein Refseq: NP_542175
• MIM: 618936
• UniProt ID: Q9BR10