Recombinant Human SPANXN3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPANXN3-4292H
• Product Overview: SPANXN3 MS Standard C13 and N15-labeled recombinant protein (NP_001009609) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Belongs to the SPAN-X family.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 15.6 kDa
• AA Sequence: MEQPTSSTNGEKTKSPCESNNKKNDEMQEVPNRVLAPEQSLKKTKTSEYPIIFVYYLRKGKKINSNQLENEQSQENSINPIQKEEDEGVDLSEGSSNEDEDLGPCEGPSKEDKDLDSSEGSSQEDEDLGLSEGSSQDSGEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPANXN3 SPANX family member N3 [ Homo sapiens (human) ]
• Official Symbol: SPANXN3
• Synonyms: SPANXN3; SPANX family member N3; CT11.8; SPANX-N3; sperm protein associated with the nucleus on the X chromosome N3; cancer/testis antigen family 11, member 8; nuclear-associated protein SPAN-Xn3
• Gene ID: 139067
• mRNA Refseq: NM_001009609
• Protein Refseq: NP_001009609
• MIM: 300666
• UniProt ID: Q5MJ09