Recombinant Human SPACA7 Protein, GST-tagged

• Cat.No.: SPACA7-526H
• Product Overview: Human C13orf28 full-length ORF (1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 47.9 kDa
• AA Sequence: MAVSQGDGTLCFVLLLCCWQETELRPRTVIPGSPTEIPFSSKQEDMSELLDEILVQEILDLNKTTPSEMPSTASTLSTPLHAGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQILQNIGRSSGNIFHKEQQRTSAQRRSQGSQ
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPACA7 sperm acrosome associated 7 [ Homo sapiens ]
• Official Symbol: SPACA7
• Synonyms: SPACA7; sperm acrosome associated 7; C13orf28, chromosome 13 open reading frame 28; protein SPACA7; sperm acrosome-associated protein 7; C13orf28; FLJ27356
• Gene ID: 122258
• mRNA Refseq: NM_145248
• Protein Refseq: NP_660291
• UniProt ID: Q96KW9