Recombinant Human SPACA4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPACA4-2108H
• Product Overview: SPACA4 MS Standard C13 and N15-labeled recombinant protein (NP_598005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13 kDa
• AA Sequence: MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLPPRLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPACA4 sperm acrosome associated 4 [ Homo sapiens (human) ]
• Official Symbol: SPACA4
• Synonyms: SPACA4; sperm acrosome associated; SAMP14; sperm acrosome membrane-associated protein 4; sperm acrosomal membrane protein 14; sperm acrosomal membrane-associated protein 14; testicular tissue protein Li 167
• Gene ID: 171169
• mRNA Refseq: NM_133498
• Protein Refseq: NP_598005
• MIM: 609932
• UniProt ID: Q8TDM5