Recombinant Human SP1 Protein, His-tagged
Cat.No. : | SP1-113H |
Product Overview : | Recombinant Human SP1 Protein, fused to His-tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a zinc finger transcription factor that binds to GC-rich motifs of many promoters. The encoded protein is involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Post-translational modifications such as phosphorylation, acetylation, glycosylation, and proteolytic processing significantly affect the activity of this protein, which can be an activator or a repressor. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | Supplied as a 0.2 μm filtered solution in 30mM Tris, 300mM NaCl, pH8.0. |
Molecular Mass : | ~18.9 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRAHLRWHTGERPFMCTW SYCGKRFTRS DELQRHKRTH TGEKKFACPE CPKRFMRSDHLSKHIKTHQN KKGGPGVALS VGTLPLDSGA GSEGSGTATP SALITTNMVA MEAICPEGIA RLANSGINVM QVADLQSILEHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.17 mg/ml |
Gene Name | SP1 Sp1 transcription factor [ Homo sapiens (human) ] |
Official Symbol | SP1 |
Gene ID | 6667 |
mRNA Refseq | NM_001251825 |
Protein Refseq | NP_001238754 |
MIM | 189906 |
UniProt ID | P08047 |
◆ Recombinant Proteins | ||
RFL32772SF | Recombinant Full Length Pig Gap Junction Gamma-1 Protein(Gjc1) Protein, His-Tagged | +Inquiry |
SH-RS04770-5629S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS04770 protein, His-tagged | +Inquiry |
EYA1-26641TH | Recombinant Human EYA1 | +Inquiry |
ICAM3-4246H | Recombinant Human ICAM3 Protein (Met1-His485), C-His tagged | +Inquiry |
LRP2BP-852H | Recombinant Human LRP2BP Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
ACTA1-853R | Native Rabbit ACTA1 Protein | +Inquiry |
KLK3-385H | Native Human Prostate Specific Antigen (PSA), High pI Isoform (IEF) | +Inquiry |
B. garinii-22 | Native Borrelia garinii Antigen | +Inquiry |
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
C7-102H | Active Native Human C7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK1-5174HCL | Recombinant Human IRAK1 293 Cell Lysate | +Inquiry |
CEP55-7573HCL | Recombinant Human CEP55 293 Cell Lysate | +Inquiry |
AMIGO3-8881HCL | Recombinant Human AMIGO3 293 Cell Lysate | +Inquiry |
TSPY3-701HCL | Recombinant Human TSPY3 293 Cell Lysate | +Inquiry |
Jugular-614R | Rat Jugular Vein Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SP1 Products
Required fields are marked with *
My Review for All SP1 Products
Required fields are marked with *
0
Inquiry Basket