Recombinant Human SOX8 protein(121-230 aa), C-His-tagged

• Cat.No.: SOX8-2795H
• Product Overview: Recombinant Human SOX8 protein(P57073)(121-230 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 121-230 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: ADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGDGHHHGDHTGQTHGPPTPPTT

Gene Information

• Gene Name: SOX8 SRY (sex determining region Y)-box 8 [ Homo sapiens ]
• Official Symbol: SOX8
• Synonyms: SOX8; SRY (sex determining region Y)-box 8; transcription factor SOX-8; MGC24837
• Gene ID: 30812
• mRNA Refseq: NM_014587
• Protein Refseq: NP_055402
• MIM: 605923
• UniProt ID: P57073