Recombinant Human SOX2 protein(11-90 aa), C-His-tagged

Cat.No. : SOX2-2771H
Product Overview : Recombinant Human SOX2 protein(P48431)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-90 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPF
Gene Name SOX2 SRY (sex determining region Y)-box 2 [ Homo sapiens ]
Official Symbol SOX2
Synonyms SOX2; SRY (sex determining region Y)-box 2; transcription factor SOX-2; transcription factor SOX2; SRY-related HMG-box gene 2; ANOP3; MCOPS3; MGC2413;
Gene ID 6657
mRNA Refseq NM_003106
Protein Refseq NP_003097
MIM 184429
UniProt ID P48431

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SOX2 Products

Required fields are marked with *

My Review for All SOX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon