Recombinant Human SOX10 Protein, Tag Free

• Cat.No.: SOX10-01H
• Product Overview: Recombinant human SOX10 protein without tag was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
• Molecular Mass: The protein has a calculated MW of 50 kDa.
• AA Sequence: MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP
• Purity: >80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.29 mg/mL
• Storage Buffer: PBS, pH7.4, 10% glycerol

Gene Information

• Gene Name: SOX10 SRY (sex determining region Y)-box 10 [ Homo sapiens (human) ]
• Official Symbol: SOX10
• Synonyms: SOX10; SRY (sex determining region Y)-box 10; transcription factor SOX-10; DOM; dominant megacolon; mouse; human homolog of; WS2E; WS4; SRY-related HMG-box gene 10; dominant megacolon, mouse, human homolog of; PCWH; WS4C; MGC15649
• Gene ID: 6663
• mRNA Refseq: NM_006941
• Protein Refseq: NP_008872
• MIM: 602229
• UniProt ID: P56693