Recombinant Human SOX10 protein(151-220 aa), C-His-tagged

• Cat.No.: SOX10-2794H
• Product Overview: Recombinant Human SOX10 protein(P56693)(151-220 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 151-220 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: RPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEG

Gene Information

• Gene Name: SOX10 SRY (sex determining region Y)-box 10 [ Homo sapiens ]
• Official Symbol: SOX10
• Synonyms: SOX10; SRY (sex determining region Y)-box 10; transcription factor SOX-10; DOM; dominant megacolon; mouse; human homolog of; WS2E; WS4; SRY-related HMG-box gene 10; dominant megacolon, mouse, human homolog of; PCWH; WS4C; MGC15649
• Gene ID: 6663
• mRNA Refseq: NM_006941
• Protein Refseq: NP_008872
• MIM: 602229
• UniProt ID: P56693