Recombinant Human SOX10 protein(151-220 aa), C-His-tagged

Cat.No. : SOX10-2794H
Product Overview : Recombinant Human SOX10 protein(P56693)(151-220 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 151-220 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : RPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEG
Gene Name SOX10 SRY (sex determining region Y)-box 10 [ Homo sapiens ]
Official Symbol SOX10
Synonyms SOX10; SRY (sex determining region Y)-box 10; transcription factor SOX-10; DOM; dominant megacolon; mouse; human homolog of; WS2E; WS4; SRY-related HMG-box gene 10; dominant megacolon, mouse, human homolog of; PCWH; WS4C; MGC15649;
Gene ID 6663
mRNA Refseq NM_006941
Protein Refseq NP_008872
MIM 602229
UniProt ID P56693

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SOX10 Products

Required fields are marked with *

My Review for All SOX10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon