Recombinant Human SOLH

Cat.No. : SOLH-27401TH
Product Overview : Recombinant fragment of Human Calpain 15 with an N terminal proprietary tag; Predicted MWt 35.97 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 94 amino acids
Description : This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development.
Molecular Weight : 35.970kDa inclusive of tags
Tissue specificity : Widely expressed with higher expression in brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
Sequence Similarities : Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 5 RanBP2-type zinc fingers.
Gene Name SOLH small optic lobes homolog (Drosophila) [ Homo sapiens ]
Official Symbol SOLH
Synonyms SOLH; small optic lobes homolog (Drosophila); small optic lobes (Drosophila) homolog; calpain-15; CAPN15;
Gene ID 6650
mRNA Refseq NM_005632
Protein Refseq NP_005623
MIM 603267
Uniprot ID O75808
Chromosome Location 16p13.3
Function calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; metal ion binding; peptidase activity; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARID4B Products

Required fields are marked with *

My Review for All ARID4B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon