Recombinant Human SOD3
| Cat.No. : | SOD3-31476TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 26-125 of Human Superoxide Dismutase 3, with an N-terminal proprietary tag, predicted MWt 36.63 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM. |
| Protein length : | 100 amino acids |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC |
| Sequence Similarities : | Belongs to the Cu-Zn superoxide dismutase family. |
| Tag : | Non |
| Gene Name | SOD3 superoxide dismutase 3, extracellular [ Homo sapiens ] |
| Official Symbol | SOD3 |
| Synonyms | SOD3; superoxide dismutase 3, extracellular; extracellular superoxide dismutase [Cu-Zn]; EC SOD; |
| Gene ID | 6649 |
| mRNA Refseq | NM_003102 |
| Protein Refseq | NP_003093 |
| MIM | 185490 |
| Uniprot ID | P08294 |
| Chromosome Location | 4pter-q21 |
| Pathway | Folate Metabolism, organism-specific biosystem; Oxidative Stress, organism-specific biosystem; Selenium Pathway, organism-specific biosystem; |
| Function | copper ion binding; heparin binding; metal ion binding; oxidoreductase activity; protein binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOD3 Products
Required fields are marked with *
My Review for All SOD3 Products
Required fields are marked with *
0
Inquiry Basket
