Recombinant Human SOCS6 protein, His-tagged

• Cat.No.: SOCS6-2666H
• Product Overview: Recombinant Human SOCS6 protein(132-385 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 132-385 aa
• AA Sequence: YSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SOCS6 suppressor of cytokine signaling 6 [ Homo sapiens ]
• Official Symbol: SOCS6
• Synonyms: SOCS6; suppressor of cytokine signaling 6; SOCS4, suppressor of cytokine signaling 4; CIS4; Cish4; HSPC060; SSI4; STAI4; STATI4; STAT induced STAT inhibitor-4; cytokine-inducible SH2 protein 4; suppressor of cytokine signaling 4; CIS-4; SOCS4; SOCS-4; SOCS-6
• Gene ID: 9306
• mRNA Refseq: NM_004232
• Protein Refseq: NP_004223
• MIM: 605118
• UniProt ID: O14544