Recombinant Human SOCS2 protein, His-tagged

• Cat.No.: SOCS2-3533H
• Product Overview: Recombinant Human SOCS2 protein(89-198 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 89-198 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: SAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SOCS2
• Synonyms: SOCS2; suppressor of cytokine signaling 2; CIS2; Cish2; SOCS 2; SSI 2; SSI2; STAT induced STAT inhibitor 2; STATI2; CIS-2; STAT induced STAT inhibitor-2; STAT-induced STAT inhibitor 2; STAT-induced STAT inhibitor-2; cytokine-inducible SH2 protein 2; suppressor of cytokine signaling-2; SSI-2; SOCS-2
• Gene ID: 8835
• mRNA Refseq: NM_003877
• Protein Refseq: NP_003868
• MIM: 605117
• UniProt ID: O14508