Recombinant Human SOCS2 protein, GST-tagged

• Cat.No.: SOCS2-3514H
• Product Overview: Recombinant Human SOCS2 protein(O14508)(1-198aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49.2 kDa
• Protein length: 1-198aa
• AA Sequence: MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SOCS2 suppressor of cytokine signaling 2 [ Homo sapiens ]
• Official Symbol: SOCS2
• Synonyms: SOCS2; suppressor of cytokine signaling 2; CIS2; Cish2; SOCS 2; SSI 2; SSI2; STAT induced STAT inhibitor 2; STATI2; CIS-2; STAT induced STAT inhibitor-2; STAT-induced STAT inhibitor 2; STAT-induced STAT inhibitor-2; cytokine-inducible SH2 protein 2; suppressor of cytokine signaling-2; SSI-2; SOCS-2
• Gene ID: 8835
• mRNA Refseq: NM_003877
• Protein Refseq: NP_003868
• MIM: 605117
• UniProt ID: O14508