Recombinant Human SOCS2 protein, GST-tagged
Cat.No. : | SOCS2-3514H |
Product Overview : | Recombinant Human SOCS2 protein(O14508)(1-198aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-198aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.2 kDa |
AA Sequence : | MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SOCS2 suppressor of cytokine signaling 2 [ Homo sapiens ] |
Official Symbol | SOCS2 |
Synonyms | SOCS2; suppressor of cytokine signaling 2; CIS2; Cish2; SOCS 2; SSI 2; SSI2; STAT induced STAT inhibitor 2; STATI2; CIS-2; STAT induced STAT inhibitor-2; STAT-induced STAT inhibitor 2; STAT-induced STAT inhibitor-2; cytokine-inducible SH2 protein 2; suppressor of cytokine signaling-2; SSI-2; SOCS-2; |
Gene ID | 8835 |
mRNA Refseq | NM_003877 |
Protein Refseq | NP_003868 |
MIM | 605117 |
UniProt ID | O14508 |
◆ Recombinant Proteins | ||
SOCS2-2871H | Recombinant Human SOCS2 protein, His-tagged | +Inquiry |
SOCS2-6109C | Recombinant Chicken SOCS2 | +Inquiry |
SOCS2-6428Z | Recombinant Zebrafish SOCS2 | +Inquiry |
SOCS2-5664R | Recombinant Rat SOCS2 Protein | +Inquiry |
SOCS2-5323R | Recombinant Rat SOCS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOCS2-1581HCL | Recombinant Human SOCS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SOCS2 Products
Required fields are marked with *
My Review for All SOCS2 Products
Required fields are marked with *
0
Inquiry Basket