Recombinant Human SNX9 protein, His-tagged

• Cat.No.: SNX9-3536H
• Product Overview: Recombinant Human SNX9 protein(1-362 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-362 aa
• AA Sequence: MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAHASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEW
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SNX9 sorting nexin 9 [ Homo sapiens ]
• Official Symbol: SNX9
• Synonyms: SNX9; sorting nexin 9; sorting nexin-9; SDP1; SH3PX1; SH3PXD3A; SH3 and PX domain-containing protein 1; SH3 and PX domain-containing protein 3A; SH3 and PX domain-containing protein SH3PX1; Wiskott-Aldrich syndrome protein (WASP) interactor protein; WISP; MST155; MSTP155
• Gene ID: 51429
• mRNA Refseq: NM_016224
• Protein Refseq: NP_057308
• MIM: 605952
• UniProt ID: Q9Y5X1