Recombinant Human SNX5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNX5-6635H |
Product Overview : | SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_689413) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 46.8 kDa |
AA Sequence : | MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNX5 sorting nexin 5 [ Homo sapiens (human) ] |
Official Symbol | SNX5 |
Synonyms | SNX5; sorting nexin 5; sorting nexin-5; FLJ10931; |
Gene ID | 27131 |
mRNA Refseq | NM_152227 |
Protein Refseq | NP_689413 |
MIM | 605937 |
UniProt ID | Q9Y5X3 |
◆ Recombinant Proteins | ||
SNX5-128H | Recombinant Human SNX5 protein, T7-tagged | +Inquiry |
SNX5-6635H | Recombinant Human SNX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Snx5-6036M | Recombinant Mouse Snx5 Protein, Myc/DDK-tagged | +Inquiry |
SNX5-12786Z | Recombinant Zebrafish SNX5 | +Inquiry |
SNX5-4399R | Recombinant Rhesus monkey SNX5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX5-1587HCL | Recombinant Human SNX5 293 Cell Lysate | +Inquiry |
SNX5-1588HCL | Recombinant Human SNX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNX5 Products
Required fields are marked with *
My Review for All SNX5 Products
Required fields are marked with *
0
Inquiry Basket