Recombinant Human SNX33 Protein, GST-tagged

• Cat.No.: SNX33-4327H
• Product Overview: Human MGC32065 partial ORF ( NP_695003, 475 a.a. - 574 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is involved in cytoskeletal reorganization, vesicle trafficking, endocytosis, and mitosis. The encoded protein is essential for the creation of the cleavage furrow during mitosis and for completion of mitosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: YQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDNL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SNX33 sorting nexin 33 [ Homo sapiens ]
• Official Symbol: SNX33
• Synonyms: SNX33; sorting nexin 33; SH3 and PX domain containing 3 , SH3PX3; sorting nexin-33; MGC32065; SH3PXD3C; SNX30; SH3 and PX domain containing 3; SH3 and PX domain-containing protein 3; SH3PX3
• Gene ID: 257364
• mRNA Refseq: NM_153271
• Protein Refseq: NP_695003
• UniProt ID: Q8WV41