Recombinant Human SNX33 Protein, GST-tagged
Cat.No. : | SNX33-4327H |
Product Overview : | Human MGC32065 partial ORF ( NP_695003, 475 a.a. - 574 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is involved in cytoskeletal reorganization, vesicle trafficking, endocytosis, and mitosis. The encoded protein is essential for the creation of the cleavage furrow during mitosis and for completion of mitosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015] |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 36.74 kDa |
AA Sequence : | YQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDNL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SNX33 sorting nexin 33 [ Homo sapiens ] |
Official Symbol | SNX33 |
Synonyms | SNX33; sorting nexin 33; SH3 and PX domain containing 3 , SH3PX3; sorting nexin-33; MGC32065; SH3PXD3C; SNX30; SH3 and PX domain containing 3; SH3 and PX domain-containing protein 3; SH3PX3; |
Gene ID | 257364 |
mRNA Refseq | NM_153271 |
Protein Refseq | NP_695003 |
UniProt ID | Q8WV41 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SNX33 Products
Required fields are marked with *
My Review for All SNX33 Products
Required fields are marked with *
0
Inquiry Basket