Recombinant Human SNX31 Protein, GST-tagged

• Cat.No.: SNX31-5278H
• Product Overview: Human MGC39715 partial ORF ( AAH31260, 242 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: SNX31 (Sorting Nexin 31) is a Protein Coding gene. GO annotations related to this gene include phosphatidylinositol binding. An important paralog of this gene is SNX17.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: QNLELRFQYSEDSCWQWFVIYTKQAFLLSSCLKKMISEKMVKLAAENTEMQIEVPEQSKSKKYHIQQSQQKDYSSFLSRKSKIKIAKGDCVFGNIKEEDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SNX31 sorting nexin 31 [ Homo sapiens ]
• Official Symbol: SNX31
• Synonyms: SNX31; sorting nexin 31; sorting nexin-31; MGC39715
• Gene ID: 169166
• mRNA Refseq: NM_152628
• Protein Refseq: NP_689841
• UniProt ID: Q8N9S9