Recombinant Human SNRPF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SNRPF-5371H
Product Overview : SNRPF MS Standard C13 and N15-labeled recombinant protein (NP_003086) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F) is a Protein Coding gene. Among its related pathways are Transport of the SLBP independent Mature mRNA and mRNA Splicing - Minor Pathway. Gene Ontology (GO) annotations related to this gene include RNA binding. An important paralog of this gene is LSM6.
Molecular Mass : 9.7 kDa
AA Sequence : MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens (human) ]
Official Symbol SNRPF
Synonyms SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F; sm protein F; SMF; Sm-F; snRNP-F;
Gene ID 6636
mRNA Refseq NM_003095
Protein Refseq NP_003086
MIM 603541
UniProt ID P62306

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SNRPF Products

Required fields are marked with *

My Review for All SNRPF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon