Recombinant Human SNRNP48 Protein, GST-Tagged

• Cat.No.: SNRNP48-1331H
• Product Overview: Human C6orf151 full-length ORF (NP_689764.3, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: SNRNP48 (Small Nuclear Ribonucleoprotein U11/U12 Subunit 48) is a Protein Coding gene. Among its related pathways are Gene Expression and mRNA Splicing - Major Pathway.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 66.4 kDa
• AA Sequence: MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIPSITLNKDSQFQIIKQARTAVGKDSDCYNQRIYSSLPVEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDSQIIENDSDLFVDLAAKINQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTEVIRDVINVHMEELSNHWQEEQEKAEDDAEKNEERRSASVDSRQSGGSYLDAECSRHRRDRSRSPHKRKRNKDKDKNCESRRRKERDGERHHSHKRRKQKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SNRNP48 small nuclear ribonucleoprotein 48kDa (U11/U12) [ Homo sapiens ]
• Official Symbol: SNRNP48
• Synonyms: SNRNP48; small nuclear ribonucleoprotein 48kDa (U11/U12); C6orf151, chromosome 6 open reading frame 151; U11/U12 small nuclear ribonucleoprotein 48 kDa protein; dJ336K20B.1; dJ512B11.2; FLJ32234; U11/U12 snRNP 48K; U11/U12-48K; U11/U12 snRNP 48 kDa protein; C6orf151; MGC138904; MGC138905
• Gene ID: 154007
• mRNA Refseq: NM_152551
• Protein Refseq: NP_689764
• UniProt ID: Q6IEG0