Recombinant Human SNAI1 protein, T7/His-tagged

• Cat.No.: SNAI1-178H
• Product Overview: Recombinant human SNAL1 (264aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPP EILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLE AEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQG HVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: SNAI1 snail homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: SNAI1
• Synonyms: SNAI1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1; protein sna; snail 1 homolog; protein snail homolog 1
• Gene ID: 6615
• mRNA Refseq: NM_005985
• Protein Refseq: NP_005976
• MIM: 604238
• UniProt ID: O95863
• Chromosome Location: 20q13.2
• Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met), organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem
• Function: RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; kinase binding; metal ion binding; protein binding; sequence-specific DNA binding; zinc ion binding