Recombinant Human SNAI1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNAI1-4718H |
Product Overview : | SNAI1 MS Standard C13 and N15-labeled recombinant protein (NP_005976) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. |
Molecular Mass : | 28.9 kDa |
AA Sequence : | MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNAI1 snail family transcriptional repressor 1 [ Homo sapiens (human) ] |
Official Symbol | SNAI1 |
Synonyms | SNAI1; snail homolog 1 (Drosophila); snail 1 (drosophila homolog), zinc finger protein; zinc finger protein SNAI1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1; protein sna; snail 1 homolog; protein snail homolog 1; snail 1 zinc finger protein; snail 1, zinc finger protein; dJ710H13.1; |
Gene ID | 6615 |
mRNA Refseq | NM_005985 |
Protein Refseq | NP_005976 |
MIM | 604238 |
UniProt ID | O95863 |
◆ Recombinant Proteins | ||
Snai1-5989M | Recombinant Mouse Snai1 Protein, Myc/DDK-tagged | +Inquiry |
SNAI1-7684H | Recombinant Human SNAI1 protein, His-tagged | +Inquiry |
SNAI1-6699C | Recombinant Chicken SNAI1 | +Inquiry |
SNAI1-30016TH | Recombinant Human SNAI1 | +Inquiry |
SNAI1-4718H | Recombinant Human SNAI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAI1-1643HCL | Recombinant Human SNAI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNAI1 Products
Required fields are marked with *
My Review for All SNAI1 Products
Required fields are marked with *
0
Inquiry Basket