Recombinant Human SMUG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SMUG1-1241H
Product Overview : SMUG1 MS Standard C13 and N15-labeled recombinant protein (NP_055126) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that participates in base excision repair by removing uracil from single- and double-stranded DNA. Many alternatively spliced transcript variants exist for this gene; the full-length nature is known for some but not all of the variants.
Molecular Mass : 29.7 kDa
AA Sequence : MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SMUG1 single-strand-selective monofunctional uracil-DNA glycosylase 1 [ Homo sapiens (human) ]
Official Symbol SMUG1
Synonyms SMUG1; single-strand-selective monofunctional uracil-DNA glycosylase 1; single-strand selective monofunctional uracil DNA glycosylase; FDG; HMUDG; UNG3; MGC104370;
Gene ID 23583
mRNA Refseq NM_014311
Protein Refseq NP_055126
MIM 607753
UniProt ID Q53HV7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SMUG1 Products

Required fields are marked with *

My Review for All SMUG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon