Recombinant Human SMPX Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SMPX-6321H
• Product Overview: SMPX MS Standard C13 and N15-labeled recombinant protein (NP_055147) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a small protein that has no known functional domains. Mutations in this gene are a cause of X-linked deafness-4, and the encoded protein may play a role in the maintenance of inner ear cells subjected to mechanical stress. Alternatively spliced transcript variants have been observed for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 9.6 kDa
• AA Sequence: MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SMPX small muscle protein X-linked [ Homo sapiens (human) ]
• Official Symbol: SMPX
• Synonyms: SMPX; small muscle protein X-linked; Csl; DFN6; DFNX4; Chisel; small muscular protein; deafness, X-linked 6, sensorineural; stretch-responsive skeletal muscle protein
• Gene ID: 23676
• mRNA Refseq: NM_014332
• Protein Refseq: NP_055147
• MIM: 300226
• UniProt ID: Q9UHP9