Recombinant Human SMARCD3 protein, GST-tagged

• Cat.No.: SMARCD3-1205H
• Product Overview: Recombinant Human SMARCD3 protein(1-88 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-88 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MTPGLQHPPTVVQRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGLAPAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SMARCD3 SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 [ Homo sapiens ]
• Official Symbol: SMARCD3
• Synonyms: SMARCD3; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3; 60kDa BRG 1/Brm associated factor subunit c; BAF60C; CRACD3; mammalian chromatin remodeling complex BRG1 associated factor 60C; Rsc6p; SWI/SNF complex 60 kDa subunit C; Swp73 like protein; Swp73-like protein; BRG1-associated factor 60C; chromatin remodeling complex BAF60C subunit; 60 kDa BRG-1/Brm-associated factor subunit C; mammalian chromatin remodeling complex BRG1-associated factor 60C; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3, isoform 1; MGC111010
• Gene ID: 6604
• mRNA Refseq: NM_001003801
• Protein Refseq: NP_001003801
• MIM: 601737
• UniProt ID: Q6STE5