Recombinant Human SMAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SMAP1-5333H
Product Overview : SMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_068759) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is similar to the mouse stromal membrane-associated protein-1. This similarity suggests that this human gene product is also a type II membrane glycoprotein involved in the erythropoietic stimulatory activity of stromal cells. Alternate splicing results in multiple transcript variants encoding different isoforms.
Molecular Mass : 48.1 kDa
AA Sequence : MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWSLSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SMAP1 small ArfGAP 1 [ Homo sapiens (human) ]
Official Symbol SMAP1
Synonyms SMAP1; small ArfGAP 1; stromal membrane associated GTPase activating protein 1, stromal membrane associated protein 1; stromal membrane-associated protein 1; FLJ13159; SMAP 1; stromal membrane-associated GTPase-activating protein 1; SMAP-1; FLJ42245;
Gene ID 60682
mRNA Refseq NM_021940
Protein Refseq NP_068759
MIM 611372
UniProt ID Q8IYB5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SMAP1 Products

Required fields are marked with *

My Review for All SMAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon