Recombinant Human SMAD4 protein, His-tagged
Cat.No. : | SMAD4-217H |
Product Overview : | Recombinant Human SMAD4 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the Smad family of signal transduction proteins. Smad proteins are phosphorylated and activated by transmembrane serine-threonine receptor kinases in response to TGF-beta signaling. The product of this gene forms homomeric complexes and heteromeric complexes with other activated Smad proteins, which then accumulate in the nucleus and regulate the transcription of target genes. This protein binds to DNA and recognizes an 8-bp palindromic sequence (GTCTAGAC) called the Smad-binding element (SBE). The Smad proteins are subject to complex regulation by post-translational modifications. Mutations or deletions in this gene have been shown to result in pancreatic cancer, juvenile polyposis syndrome, and hereditary hemorrhagic telangiectasia syndrome. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM Tris, pH 8.0 |
Molecular Mass : | 61.5kD |
AA Sequence : | MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTG |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | SMAD4 SMAD family member 4 [ Homo sapiens ] |
Official Symbol | SMAD4 |
Synonyms | SMAD4; SMAD family member 4; MAD, mothers against decapentaplegic homolog 4 (Drosophila) , MADH4, SMAD, mothers against DPP homolog 4 (Drosophila); mothers against decapentaplegic homolog 4; DPC4; MAD homolog 4; SMAD, mothers against DPP homolog 4; deleted in pancreatic carcinoma locus 4; deletion target in pancreatic carcinoma 4; mothers against decapentaplegic, Drosophila, homolog of, 4; JIP; MADH4; MYHRS; |
Gene ID | 4089 |
mRNA Refseq | NM_005359 |
Protein Refseq | NP_005350 |
MIM | 600993 |
UniProt ID | Q13485 |
◆ Recombinant Proteins | ||
SMAD4-8457M | Recombinant Mouse SMAD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SMAD4-31193TH | Recombinant Human SMAD4 | +Inquiry |
SMAD4-2042H | Recombinant Human SMAD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Smad4-1978M | Recombinant Mouse Smad4 protein, His & T7-tagged | +Inquiry |
SMAD4-4332R | Recombinant Rhesus monkey SMAD4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMAD4-1676HCL | Recombinant Human SMAD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMAD4 Products
Required fields are marked with *
My Review for All SMAD4 Products
Required fields are marked with *
0
Inquiry Basket