Recombinant Human SLURP1 protein

• Cat.No.: SLURP1-3505H
• Product Overview: Recombinant Human SLURP1 protein(P55000)(23-103aa) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 23-103aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 8.9 kDa
• AA Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SLURP1 secreted LY6/PLAUR domain containing 1 [ Homo sapiens ]
• Official Symbol: SLURP1
• Synonyms: SLURP1; secreted LY6/PLAUR domain containing 1; secreted Ly-6/uPAR-related protein 1; ANUP; ARS; ARS component B; ArsB; LY6LS; lymphocyte antigen 6 like secreted; MDM; SLURP-1; ARS(component B)-81/S; anti-neoplastic urinary protein; lymphocyte antigen 6-like secreted; secreted Ly6/uPAR related protein 1
• Gene ID: 57152
• mRNA Refseq: NM_020427
• Protein Refseq: NP_065160
• MIM: 606119
• UniProt ID: P55000