Recombinant Human SLPI, His-tagged

• Cat.No.: SLPI-30969TH
• Product Overview: Recombinant full length Human SLPI with an N terminal His tag; 128 amino acids with tag, Predicted MWt 14.0kDa.

Specification

• Description: This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases.It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G.Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity.
• Protein length: 107 amino acids
• Conjugation: HIS
• Molecular Weight: 14.000kDa
• Source: E. coli
• Tissue specificity: Mucous fluids.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
• Sequence Similarities: Contains 2 WAP domains.

Gene Information

• Gene Name: SLPI secretory leukocyte peptidase inhibitor [ Homo sapiens ]
• Official Symbol: SLPI
• Synonyms: SLPI; secretory leukocyte peptidase inhibitor; secretory leukocyte protease inhibitor (antileukoproteinase); antileukoproteinase; ALK1; ALP; BLPI; HUSI; HUSI I; WAP4; WFDC4
• Gene ID: 6590
• mRNA Refseq: NM_003064
• Protein Refseq: NP_003055
• MIM: 107285
• Uniprot ID: P03973
• Chromosome Location: 20pter-p12.3
• Function: endopeptidase inhibitor activity; enzyme binding; protein binding; serine-type endopeptidase inhibitor activity