Recombinant Human SLPI, His-tagged
Cat.No. : | SLPI-30969TH |
Product Overview : | Recombinant full length Human SLPI with an N terminal His tag; 128 amino acids with tag, Predicted MWt 14.0kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 107 amino acids |
Description : | This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases.It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G.Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity. |
Conjugation : | HIS |
Molecular Weight : | 14.000kDa |
Tissue specificity : | Mucous fluids. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA |
Sequence Similarities : | Contains 2 WAP domains. |
Gene Name | SLPI secretory leukocyte peptidase inhibitor [ Homo sapiens ] |
Official Symbol | SLPI |
Synonyms | SLPI; secretory leukocyte peptidase inhibitor; secretory leukocyte protease inhibitor (antileukoproteinase); antileukoproteinase; ALK1; ALP; BLPI; HUSI; HUSI I; WAP4; WFDC4; |
Gene ID | 6590 |
mRNA Refseq | NM_003064 |
Protein Refseq | NP_003055 |
MIM | 107285 |
Uniprot ID | P03973 |
Chromosome Location | 20pter-p12.3 |
Function | endopeptidase inhibitor activity; enzyme binding; protein binding; serine-type endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
SLPI-2704H | Recombinant Human SLPI Protein, His-tagged | +Inquiry |
Slpi-3516M | Recombinant Mouse Slpi, His-tagged | +Inquiry |
Slpi-5945M | Recombinant Mouse Slpi Protein, Myc/DDK-tagged | +Inquiry |
SLPI-2349H | Recombinant Human SLPI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLPI-15575M | Recombinant Mouse Slpi protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLPI-530HCL | Recombinant Human SLPI cell lysate | +Inquiry |
SLPI-001HCL | Recombinant Human SLPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLPI Products
Required fields are marked with *
My Review for All SLPI Products
Required fields are marked with *
0
Inquiry Basket