Recombinant Human SLITRK3, His-tagged

• Cat.No.: SLITRK3-191H
• Product Overview: Recombinant Human SLIT and NTRK-Like Protein 3/SLITRK3 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Thr29-Ser654) of Human SLITRK3 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 29-654 a.a.
• Description: SLIT and NTRK-Like Protein 3 (SLITRK3) is a member of the SLITRK family that are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. SLITRK3 contains an N-terminal signal peptide, followed by two LRR domains, a transmembrane domain, and a cytoplasmic domain with a putative tyrosine phosphorylation site. Each LRR domain is flanked by cysteine-rich regions. SLITRK3 is expressed at higher levels in some astrocytic brain tumors such as strocytomas, oligodendrogliomas, glioblastomas, gangliogliomas and primitive neuroectodermal tumors.
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• AA Sequence: TPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLY TNSFLHLNNAVSINLGNNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADY NVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIGRS LMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSE VEASLGIPHSSSSKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQALYP GPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSN LIQKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLH YLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVL EHLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPE MLHVAPAGESPAQPGDSHLIGAPTSASPYEFSPPGGPVPLSVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: SLITRK3 SLIT and NTRK-like family, member 3 [ Homo sapiens ]
• Official Symbol: SLITRK3
• Synonyms: SLITRK3; SLIT and NTRK-like family, member 3; SLIT and NTRK-like protein 3; KIAA0848; slit and trk like gene 3; MGC138681
• Gene ID: 22865
• mRNA Refseq: NM_014926
• Protein Refseq: NP_055741
• MIM: 609679
• UniProt ID: O94933
• Chromosome Location: 3q26.1