Recombinant Human SLIT1 protein, His-tagged

• Cat.No.: SLIT1-7837H
• Product Overview: Recombinant Human SLIT1 protein(1342-1503 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1342-1503 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: CRKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGLQCLHGHCQASGTKGAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQGLRL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SLIT1
• Synonyms: SLIT1; slit homolog 1 (Drosophila); SLIL1, slit (Drosophila) homolog 1; slit homolog 1 protein; MEGF4; Slit 1; slit1; SLIT3; multiple EGF-like domains protein 4; multiple epidermal growth factor-like domains protein 4; SLIL1; SLIT-1; MGC164811
• Gene ID: 6585
• mRNA Refseq: NM_003061
• Protein Refseq: NP_003052
• MIM: 603742
• UniProt ID: O75093